<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05650
Description |
Uncharacterized protein |
Sequence | MAGNFWQSSHYDQWIFDKHELLRMRSEDLKIYTEEEYQKLMIFWANLIQTLAVEGIQQGQPKTRMQVIATAIVYFKRFYARRSYKDVDPLLIACASVFLSSKVEEHGLMSMSNLIKTIPNCLKKWPNLTYDASSKNSGLYDAEFILVEMLDCCLVVYHPYRPLSTMLQVANDSLRSDCCLLYPPHIIAISCVIVGAELMNREKDIKMWLPELSADFEKVYDCVNTIFSMYKTWKTFDEKEHVKPLFDKLPKINAGPSF |
Length | 258 |
Position | Kinase |
Organism | Angiostrongylus costaricensis (Nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.121 |
Instability index | 47.43 |
Isoelectric point | 6.32 |
Molecular weight | 30044.66 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05650
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.84| 9| 23| 151| 160| 2
---------------------------------------------------------------------------
151- 160 (18.17/15.52) DCCLvVYHPY
177- 185 (22.67/14.24) DCCL.LYPPH
---------------------------------------------------------------------------
|