<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05648
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MRRQDRRVHTYLLTLFFEVLISYIFNQLFYCETSKAALTSMPYQCQELILYGSVFADNLQDLERRLTGLCDPGSTEFHEHDLSFSLRTGTDPDVTIRLRRRFNVDSFTSHQWQFRYIGGPEPDQKCPVIVRKVIDSIAYSHLMMDFVKTLGLRMDYEYIAKGTVWTNGRMKVVISQIQRTEKAGHYDQSNLKRFADSYLVEISACLPDSAEYSATAKQLRDFADQLLPLVEMEKVDYWRK |
Length | 240 |
Position | Head |
Organism | Angiostrongylus costaricensis (Nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.349 |
Instability index | 41.94 |
Isoelectric point | 6.60 |
Molecular weight | 28102.79 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.63| 27| 28| 84| 110| 1
---------------------------------------------------------------------------
79- 108 (42.42/27.01) EHdlsFSLRTGTDPDVTIRLRRRFNVDSFT
109- 138 (44.21/28.40) SHqwqFRYIGGPEPDQKCPVIVRKVIDSIA
---------------------------------------------------------------------------
|