<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05619
Description |
Uncharacterized protein |
Sequence | MDPDSKKFGGGPRELTDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYRIQPLDLNILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDEEKKHKKHKDRDKDKDKEHKKHKHRQKDRSKDKEKEKKKDKNRHRDSSADPSKKHNEKKRKHDGDDDLNVVHKHKKSKVIKGEALSPDKFSIFHSHLFLLYKLSAVYCFS |
Length | 207 |
Position | Head |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.315 |
Instability index | 34.41 |
Isoelectric point | 9.47 |
Molecular weight | 23844.72 |
Publications | PubMed=20075913
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05619
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.71| 15| 15| 106| 120| 1
---------------------------------------------------------------------------
106- 120 (27.82/10.77) KDRDKDKDKEHKKHK
124- 138 (23.89/ 8.22) KDRSKDKEKEKKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.91| 13| 15| 21| 33| 4
---------------------------------------------------------------------------
21- 33 (21.37/15.22) LYNVVGDIEIRKG
38- 50 (20.54/14.40) LDQLIQDTSLSSG
---------------------------------------------------------------------------
|