<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05612
| Description |
Uncharacterized protein |
| Sequence | MFNPVSFLYQHNSLPTQPKLDQLEKMNVFKMLERIIAFLQVSKSNISPNFKEKLGSYENHIINFINRKRHKKAMPPMQSRQLPLPHIDWQEEVYQKIKSMKENYLPELNEMYQKSASKLQRHTSLPQQPKSYKLEKLKKFMKMLECAIAFLQVSKSNMSPNYRLKLDSCEKQIIKIININRPKKIVPPLQYGQFPPPHMQSH |
| Length | 202 |
| Position | Tail |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.710 |
| Instability index | 63.13 |
| Isoelectric point | 9.91 |
| Molecular weight | 23995.02 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05612
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.92| 24| 25| 24| 48| 1
---------------------------------------------------------------------------
30- 57 (33.17/18.15) KMLERIIAFLQVSKSNISP......nfkEKlGSY
142- 174 (35.76/16.27) KMLECAIAFLQVSKSNMSPnyrlkldscEK.QII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 165.63| 53| 109| 6| 88| 2
---------------------------------------------------------------------------
6- 88 (83.15/48.25) SFLYQHNSLPTQPKLDQLEKMNVF.kmleriiaflqvsksnispNFKeklgsyenhiiNFINRKRHKKAMPPMQSRQLPLPHID
117- 200 (82.48/41.33) SKLQRHTSLPQQPKSYKLEKLKKFmkmlecaiaflqvsksnmspNYRlkldscekqiiKIININRPKKIVPPLQYGQFPPPHMQ
---------------------------------------------------------------------------
|