<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05611
Description |
Uncharacterized protein |
Sequence | MDPDSKKFGGGPRELTDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYHIQPLDLDILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVSIRAQKLMNWGQ |
Length | 186 |
Position | Head |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.520 |
Instability index | 30.89 |
Isoelectric point | 9.48 |
Molecular weight | 21368.81 |
Publications | PubMed=20075913
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05611
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.54| 14| 15| 106| 120| 1
---------------------------------------------------------------------------
92- 105 (25.49/ 6.46) KGESKDVEKKHKKH
106- 119 (26.17/ 6.89) KDRDKDKDKEHRKH
124- 137 (23.88/ 6.21) KDQTKDKEKEKKKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.70| 15| 15| 138| 152| 2
---------------------------------------------------------------------------
138- 152 (27.23/13.62) KNRHHDSSADPSKKH
155- 169 (27.46/13.80) KKRKHGGDDDLNGVH
---------------------------------------------------------------------------
|