<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05572
| Description |
Uncharacterized protein |
| Sequence | MKESYLPELNEMYQKIATQLQQHNSLPTQPKLDQLEKMNVFKMLERIIAFLQVSKSNISPNFMEKLGSYENHIINFINRETRFI |
| Length | 84 |
| Position | Tail |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.513 |
| Instability index | 48.28 |
| Isoelectric point | 8.03 |
| Molecular weight | 10032.53 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05572
No repeats found
No repeats found
|