<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05553
| Description |
"Uncharacterized protein, isoform B" |
| Sequence | MNPLDKIHALDEIEKDIILCMQSAGQALQELVSTGQPHEGSGYASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQQKRQQEHAAAQQQQAAAAAAQQQQQTAVAAGGSGSTDGSGVGIGNTSSVSGIATDAGGSMPAS |
| Length | 144 |
| Position | Head |
| Organism | Drosophila mojavensis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.614 |
| Instability index | 61.12 |
| Isoelectric point | 6.64 |
| Molecular weight | 15060.43 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.36| 17| 18| 75| 91| 1
---------------------------------------------------------------------------
75- 91 (29.82/12.58) HAARQQQQKRQQEHAAA
95- 111 (25.55/ 9.93) QAAAAAAQQQQQTAVAA
---------------------------------------------------------------------------
|