<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05547
Description |
"Uncharacterized protein, isoform B" |
Sequence | MPSRTPFPLDAQTPCIAQRWCSSCKRNRLAKSSGAMAFEILKLARRESHIQISKITQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRTTQIECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
Length | 144 |
Position | Head |
Organism | Drosophila mojavensis (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.396 |
Instability index | 53.98 |
Isoelectric point | 7.61 |
Molecular weight | 16659.12 |
Publications | PubMed=17994087
|
Function
Annotated function |
|
GO - Cellular Component | chromatin GO:0000785 IEA:EnsemblMetazoa
mediator complex GO:0016592 IEA:EnsemblMetazoa
nucleolus GO:0005730 IEA:EnsemblMetazoa
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription from RNA polymerase II promoter involved in spermatogenesis GO:1902064 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP05547
No repeats found
|