<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05535
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MDVTGPETDWRSTTFRQKLVSQIVPSRGQIWIQFTRGVMEKGHDDAMRKAGVAHNKSSKDMESHVFMKAKTREEYLSLVARLIIHFRDIHPMNALQNLTGGPPAGAPGMGMASRAQGAPMSGMSGIGPMGQQMSLPGQQQPPGTSGMAPHGMPGVSAATQQSKSSAGPAAASSSSSASSSGPSCSDGSFRADDHRTYGPRWDANKTTVPAYHRCVCYTAKLHSFGRTANATVLMAISNKVDVKYCPESLKSNTGGTVVMGENRKLNTLISCRSEDTLLSVSQNNITMMSSPSPVXQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSSQSEEQQYLEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPAVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIKNPRQYGMRMLA |
| Length | 606 |
| Position | Tail |
| Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.582 |
| Instability index | 71.14 |
| Isoelectric point | 9.50 |
| Molecular weight | 65464.96 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05535
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.65| 21| 27| 291| 317| 1
---------------------------------------------------------------------------
296- 317 (40.42/16.71) QAQTPQSMpPPPQPQPSPQPGQ
351- 371 (37.23/ 8.35) AARTPQNF.SVPSPGPLNTPGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 133.26| 25| 27| 117| 141| 2
---------------------------------------------------------------------------
117- 135 (28.80/ 7.86) ..........G.APMSGMSGIGPMGQQMSL
136- 164 (30.69/ 8.84) PGQQQPpgtsGmAP.HGMPGVSAATQQSKS
165- 189 (37.95/12.61) SAGPAA....A.SSSSSASSSGPSCSDGSF
327- 348 (35.83/11.51) SSGPAP......SPSSFLPSPSPQPSQS..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.78| 23| 27| 420| 446| 3
---------------------------------------------------------------------------
411- 438 (35.18/19.83) DKNEdrkkdLSKMKSLLDILTDPSKRCP
443- 467 (38.60/14.61) QKCE...iaLEKLKNDMAVPTPPPPAVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.65| 20| 26| 194| 217| 4
---------------------------------------------------------------------------
194- 216 (27.59/40.20) HrTYGpRwDANKTTVPAYHRCV....C
222- 245 (31.06/17.03) H.SFG.R.TANATVLMAISNKVdvkyC
---------------------------------------------------------------------------
|