| Description | Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MEAPPVTMMPVSGGTINMMEYLLQGSVLDQCLESLLHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDKSGMPWHLRYLGQPEIGDKSRHALVRNCVDIATSDNLTDFLVEMGFRMDHEFVAKGHVFRKGIMKIMVYKIFRILMPGNTDSIEPLSLSYLVELNVVAPAGQDIVSDDMRNFAEQLKPLVHLEKIDPKRLM |
| Length | 208 |
| Position | Head |
| Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.084 |
| Instability index | 44.45 |
| Isoelectric point | 5.97 |
| Molecular weight | 23705.56 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 132.32| 39| 63| 19| 58| 1
---------------------------------------------------------------------------
19- 58 (65.08/50.49) MEYLLQGSVLDQCLESLLHRLRGLCDNMEPETFLdHEMVF
85- 123 (67.24/47.09) LRYLGQPEIGDKSRHALVRNCVDIATSDNLTDFL.VEMGF
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FVLRARR 2) MPWHLRYLGQ | 68 81 | 74 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab