<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05527

Description Mediator of RNA polymerase II transcription subunit 28
SequenceMVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPRNSNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELKNELQRKEALIQKHLGKLRHWQQVLEDISIQHKKPAEMPQGPLAYLEQASANIPAPMKQT
Length205
PositionHead
OrganismAmazona aestiva (Blue-fronted Amazon parrot)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
Aromaticity0.05
Grand average of hydropathy-0.590
Instability index51.44
Isoelectric point5.42
Molecular weight16760.88
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05527
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.46|      18|      30|     122|     140|       1
---------------------------------------------------------------------------
  122-  140 (24.82/27.45)	FLQKRLQlSVQKPEQVIKE
  155-  172 (31.64/28.44)	LIQKHLG.KLRHWQQVLED
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05527 with Med28 domain of Kingdom Metazoa

Unable to open file!