<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05526
| Description |
Mediator of RNA polymerase II transcription subunit 30 isoform X1 |
| Sequence | MSTPPLAGAGIPPGAFSGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPVEQLIPYVEEDGSKHDDRSAASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 179 |
| Position | Head |
| Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.503 |
| Instability index | 44.68 |
| Isoelectric point | 8.46 |
| Molecular weight | 20412.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05526
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 76| 96| 1
---------------------------------------------------------------------------
76- 96 (35.37/22.97) KLQEHLRQLSILFRKLR.LVYD
149- 170 (32.88/20.92) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|