<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05525

Description Mediator of RNA polymerase II transcription subunit 24 isoform X1
SequenceMKVVNLKQAILQAWKERWSDYQWAINMKRFFPRGATWDILNLAGPGPRGEREPRRCGAARSGAAELDPWLRQPEAQPMMVSYSTVLMAISKFDDFSRDLCVQSLLEIMDMFCDRLSCHGKAEECISLCRALLSALNWLLRCAAFYAEKVKETLEQVAAEAQLKMCLERLEKMLGSTKNRALIHIAKLEEASSWSTVEQSLVKLGENLNNLSNSPLRSQADDCXSLIKSIPTMLSVHSEQLNKTGFPTVHAVVLLEGTMNLTGETQPLVEQLMMVKRMQRIPSPLFVLEIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYPQGEKQDFTEDVNCAFKFLLKLTPLLDKADQRCNCDCTSLLLQECGKQGLLSEANMNKLIDKRTVDRNQAPCLKSAEXANIQPNPRLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFIKLNEFTKHITSEDSCKYVILSESSPPGEVPFFETWMLTCMPEEGKILNPDHPCFRPDSTKVESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLTFDSIQKITDNIKGKVCSMAVCAVAWLVAHVRMLGLDEREKSLQMIRQLATPLCSENTLQFYNERVVIMSSILEHMCADVLQQTATQIKFPSTGMDTIPYWNLLPPKKPIKEVLTSVFTKVLEKGWVDSHSIHVFDTLLHMGGVYWFCNNLVKELLKETRKEHTLRAVELLYAIFCLDMQQLTLTLLGHILPNLLTDSSKWHMLMDPPGKALANLSFEAFPPLPSDLQDFFGLFAAVMWKCCFLQPYRSMSSSLSASQLHIISMRDPLNRVLANLFLLISSILGAKTAGTHTQFVQWFMEECVDCLEQGSRSSILQFMPFTMVSELVKVSTMSSPKIVLAITDLSLPLGRRVAAKAIAAL
Length938
PositionTail
OrganismAmazona aestiva (Blue-fronted Amazon parrot)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
Aromaticity0.07
Grand average of hydropathy0.017
Instability index48.59
Isoelectric point7.20
Molecular weight105078.95
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05525
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     180.39|      47|      66|     820|     866|       1
---------------------------------------------------------------------------
  777-  806 (42.93/19.45)	....................SKWHM..LMDPPGKALA..NLSFEAFPPLPSDLQ
  820-  866 (78.80/41.00)	CFLQPYRS.....MSSSLSASQLHIISMRDPLNRVLA..NLFLLISSILGAKTA
  883-  931 (58.66/28.90)	CLEQGSRSsilqfMPFTMVSELVKVSTMSSP.KIVLAitDLSLP....LGRRVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.38|      36|     239|      93|     136|       7
---------------------------------------------------------------------------
   93-  136 (58.52/56.94)	DDFSRDL.C.......VQSLLEIMDMFCDrlsChgkaeECISL....C..RALLSALN
  333-  382 (48.86/29.84)	QDFTEDVnCafkfllkLTPLLDKADQRCN...C.....DCTSLllqeCgkQGLLSEAN
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05525 with Med24 domain of Kingdom Metazoa

Unable to open file!