<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05521
Description |
Cyclin-C isoform X6 |
Sequence | MEQAEPXNLGNGLQWILDKQDLLKERQKDLKFLTEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
Length | 284 |
Position | Kinase |
Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.182 |
Instability index | 47.11 |
Isoelectric point | 6.15 |
Molecular weight | 33104.18 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05521
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 216| 229| 1
---------------------------------------------------------------------------
216- 229 (20.63/16.62) QW..FAELSvDMEKIL
241- 255 (20.73/11.72) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|