<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05519
| Description |
Ranscription elongation factor A2 |
| Sequence | MGGEEEIVRIARRLDKMVAKKSADGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLGRGKLLLWLLALSVTVGSNKRQEPPKTPTTPKITTFPPAPVTCDAVRNKCREMLTAALQADDDYVXIGADCEHIAAQIEEYILTAQGFLKGLHASRPENECA |
| Length | 181 |
| Position | Unknown |
| Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.210 |
| Instability index | 58.87 |
| Isoelectric point | 8.65 |
| Molecular weight | 19804.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05519
No repeats found
|