<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05519

Description Ranscription elongation factor A2
SequenceMGGEEEIVRIARRLDKMVAKKSADGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLGRGKLLLWLLALSVTVGSNKRQEPPKTPTTPKITTFPPAPVTCDAVRNKCREMLTAALQADDDYVXIGADCEHIAAQIEEYILTAQGFLKGLHASRPENECA
Length181
PositionUnknown
OrganismAmazona aestiva (Blue-fronted Amazon parrot)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
Aromaticity0.03
Grand average of hydropathy-0.210
Instability index58.87
Isoelectric point8.65
Molecular weight19804.94
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
translation elongation factor activity	GO:0003746	IEA:UniProtKB-KW

GO - Biological Process
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05519
No repeats found




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05519 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA