<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05517
| Description |
Uncharacterized protein |
| Sequence | MKKGSSFSGVNLSAGYFERTLWLIKLPVFSFYMANIPGTMQSLQSQSILPQMQFGLTRGHPQSSDPNDE |
| Length | 69 |
| Position | Head |
| Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.286 |
| Instability index | 78.15 |
| Isoelectric point | 8.16 |
| Molecular weight | 7698.70 |
| Publications | PubMed=20148030
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05517
No repeats found
No repeats found
|