<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05514
Description |
Uncharacterized protein |
Sequence | MDEVPAADRARGITPMEFRLVKIHMSFHIWRLAQQVKVRQRVIATAITYFRRVYTRKSMTEYDPRLVAPACLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTSWFEELRVDMNIVKSISMVILDFYDTYKIDPQRGLPEDKIIPVMNKLPSKV |
Length | 238 |
Position | Kinase |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.009 |
Instability index | 43.35 |
Isoelectric point | 8.27 |
Molecular weight | 27930.65 |
Publications | PubMed=20148030
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05514
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.82| 10| 21| 41| 50| 1
---------------------------------------------------------------------------
41- 50 (17.35/10.82) RVIATAITYF
65- 74 (18.46/11.89) RLVAPACLYL
---------------------------------------------------------------------------
|