Description | Mediator of RNA polymerase II transcription subunit 22 isoform X2 |
Sequence | MSQARALPQSKETLLQSYNKRLRDDVRSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINXRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSRYK |
Length | 140 |
Position | Head |
Organism | Amazona aestiva (Blue-fronted Amazon parrot) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.729 |
Instability index | 77.75 |
Isoelectric point | 5.03 |
Molecular weight | 16279.14 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05512 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MSIPYACK 2) RLILLY 3) YYLEPLPL | 1 32 935 | 8 37 942 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab