<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05502

Description Cyclin-dependent kinase 19
SequenceMLEILKFNCIAYCQSQVLVTTVDVLFELSSFSVFPFHANLTDFIPEGHAERIKEFDRPGIXLFRDSSLYLAMVLKSLCLSFQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIXYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQNQHQQQTAPQQQPQAAPQQPQPQQQNSTQTNGTAGAAGTGGGGAGTGLQHSQDSSLNQVPPNKKPRIGPSGANSGGPVMPSDYQHSSSRLSYQSNIQGSSQSQSTMGYSTSSQQSSQYHQSHQSHRANMF
Length519
PositionKinase
OrganismAmazona aestiva (Blue-fronted Amazon parrot)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Psittaciformes> Psittacidae> Amazona.
Aromaticity0.09
Grand average of hydropathy-0.534
Instability index56.02
Isoelectric point7.73
Molecular weight58746.96
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05502
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.99|      13|      18|     334|     348|       1
---------------------------------------------------------------------------
  334-  348 (17.60/13.11)	PTKRITSeqALQDPY
  355-  367 (24.39/11.94)	PTSDVFA..GCQIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.77|      29|      37|     407|     440|       2
---------------------------------------------------------------------------
  407-  439 (44.05/36.33)	QQPQPqqqNSTQTNGTAGaAGTGGGGAGTGLQH
  446-  474 (53.72/30.43)	NQVPP...NKKPRIGPSG.ANSGGPVMPSDYQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      41|     165|     179|       3
---------------------------------------------------------------------------
  165-  179 (26.77/18.13)	DLKPANILVMGEGPE
  203-  217 (28.67/19.91)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05502 with CDK8 domain of Kingdom Metazoa

Unable to open file!