<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05482
Description |
Uncharacterized protein |
Sequence | MSGSNQMDSDGKFGKGPRELTGAVDLISRYRLLNHHSFFCKKPLPLAISDTHYLNNVVGDTEIRKGEGMEIDQLIQNSHLRENTAYIQPFDMETLGHAFQLRETAPVDLSSKRKHEGMEDLADHKSAKINQMGNERC |
Length | 137 |
Position | Head |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.732 |
Instability index | 25.29 |
Isoelectric point | 6.14 |
Molecular weight | 15471.25 |
Publications | PubMed=20148030
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP05482
No repeats found
|