<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05476

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAGELGQQTVELGAVVRRAAEESYLGLRELVEKSQAESEGKGAYGGRQRSDSEKKIDLLKFIARTRQRMLRLHVLAKWCQQVPLVQYCQQLGSTLSSHETCFTQTADSLFFMHEGLQQARAPTFDVPSALEVMLTGSYQRLPRCIEDIGSQNKLSPDEEKHALQKLDTSVRYKVLMTPRPKEVSNVSVTDGIAVFRVDGEFKVLLTLGYRGNLDLWRILHMELLVGEKGGPIKLAESRRFVLGDDIERRMAVSDNPFSVLYTILHELCISLGMDTIIRQANVLRQGRWKEAIRSELISDSTTGQTANAAPMQLGQDGEFDSSGFRLPGLKVNYWLDEKNSGTAESDLSPFIKIEAGQDLQIKCQHSSFILDPLTDKEANISLDMCCIDVEKLILRAIACNRHTRLLDIQRQLCKNVQISQSPKDVILKRDVEVAREPHKKAEKMGFADCCGNEVLQVRAYGQAYIGLGLNIRSGRFLLQSPKNILPPSALLDWEEALNKGSATATEVFSSLRTRSILHLFAATGSFFGLKVYQQSQGTLKIPKAILHGSDLMVMGFPQCANAYYLLMQLDKDFRPVFHLLETQSDTSNKANENIDAKEAMRVNKIDVDQMHIMKYENSTNLFDTKLHTLQSIESCDDMMDNGLPIQNMGDPLPLLPACSPSFSSIVDEIFECEHDSTLPSASHVGSCSLGLQGASTRAMSPMQDGASSHAQANVTSIVHPSVSLNSYFPSSSRHLQSTNTFSSSPVRNSSAIKLSGSKSNRDLSSLSSPSEHGSADGNNTLQLIPSSKVNSNQNPGQSSYSGGLRNSLPGHLAHVSSTIGGLGKAIPEGSDCASRKRSLSDFLLNLPSLQGLKSSEPSKRRKLSESMQSSPPLQAQRSNLQSRTKLTYGNILAERNNCVPATVYASVLLHVIRHSSLCIKHAQLTAQMDSRAIPYVEEVGMRSPSSNLWLRLPFAQDDSWKHICLRLGKAGSMSWDVRINDPHFKELWELNAGSTTTPWGAGVRIANTSEMDSHISFDADGVVLTYSTVDADSVKRLVSDLHRLANARAFARGMRTSIGVKLDDKLDDSQTSMGIKSQPVHKGNSDAADRLSEQAGKPFRIEAVGLMSFWFSYGPTHMPMVHFVVEWETAKEGCTMHVSPDQLWPHTKFLEDFVNGGEVPSFLDCIRLTAGPLLALGGAIRPARMPVTVSSGYTSMQKQTNNVPTQGPLTNGSSATTMHHASAPSNVAAAHLGNHNLHAAAMLSAAGRGGSGLVPSSLLPFDVSVVLRGPYWIRIIYRKKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNALEPAFMNATQAAPHLNTSAPQSAASANRLNVTPGVHMSRPTSGVANQMAASLSRAGNAMLSSSGLASGIGGASVRLTPGTGLPVHMKGELNTAFIGLGDDGGYGGGWVPLAALKKVLRGILKYLGVLWLFAQLPELLKEILGSILKDNEGALLNLDQEQPALRFYVGGYVFAVSVHRVQLLLQVLSVKRFHHQQQQQQAQSNAQEELTAAEISEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFLKLITWKKGFSQAHGDIATAQRARIELCLENHSGSASDDNTESSLAKSNIHHDRAHSSVEFALTFVLDHALIPHMNVAGGAAWLPYCVSVRLRYSFGDNSHISFLAMDGSHGGRACWLQYEDWERCKQKVARAVETVNGSAAVGELGQGRLRMVAEMIQKQLQLCLQQLRDGSLSAGSTAS
Length1761
PositionTail
OrganismBrachypodium distachyon (Purple false brome) (Trachynia distachya)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Brachypodieae> Brachypodium.
Aromaticity0.06
Grand average of hydropathy-0.225
Instability index50.75
Isoelectric point7.97
Molecular weight192264.62
Publications
PubMed=20148030

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
plasmodesma	GO:0009506	IEA:EnsemblPlants
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
cold acclimation	GO:0009631	IEA:EnsemblPlants
positive regulation of cell population proliferation	GO:0008284	IEA:EnsemblPlants
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
systemic acquired resistance	GO:0009627	IEA:EnsemblPlants

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP05476
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     302.59|      97|     112|     208|     318|       1
---------------------------------------------------------------------------
  166-  200 (27.84/ 9.25)	........................................................................L...DT...SVRY.KVLMTPRPKE.VSNVSVTDGIAVFRV.........DGE
  208-  318 (142.43/140.29)	GYR..G.NLDLWrilhmellVGEKGGPIKLAESRRFV...LGDDIerRMAVSDNPFsVLYTIL.HELCISLGM...DT...IIRQANVLRQGRWKEaIRSELISDSTTGQTANaaPMQLGQDGE
  323-  432 (132.33/93.85)	GFRlpGlKVNYW........LDEKNSGTAESDLSPFIkieAGQDL..QIKCQHSSF.ILDPLTdKEANISLDMcciDVeklILRAIACNRHTRLLD.IQRQLCKNVQISQSPK..DVILKRDVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.64|      12|      16|     798|     809|       2
---------------------------------------------------------------------------
  798-  809 (21.78/11.75)	SSYSGGLRNSLP
  816-  827 (19.86/ 9.97)	SSTIGGLGKAIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.81|      21|      21|     834|     854|       3
---------------------------------------------------------------------------
  834-  854 (35.23/18.17)	SRKRSLSDFLLNLPSLQGLKS
  858-  878 (36.58/19.14)	SKRRKLSESMQSSPPLQAQRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.58|      15|      16|    1219|    1233|       4
---------------------------------------------------------------------------
 1219- 1233 (26.57/17.14)	HHASAPSNVAAAHLG
 1235- 1249 (26.01/16.61)	HNLHAAAMLSAAGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.01|      16|      16|    1301|    1316|       5
---------------------------------------------------------------------------
 1301- 1316 (32.13/17.86)	PKGGPSVGGSLPC..PQF
 1318- 1335 (24.88/12.07)	PFIMEHVAQGLNAlePAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.10|      19|      21|    1433|    1452|       7
---------------------------------------------------------------------------
 1433- 1452 (31.90/22.57)	Y.GGGWV....PlAALKKVLRGILK
 1453- 1476 (25.20/12.58)	YlGVLWLfaqlP.ELLKEILGSILK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.41|      15|      21|    1182|    1196|       8
---------------------------------------------------------------------------
 1182- 1196 (28.35/15.89)	PARMPVTVSSGYTSM
 1204- 1218 (28.05/15.64)	PTQGPLTNGSSATTM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.80|      21|      23|     957|     979|       9
---------------------------------------------------------------------------
  957-  979 (32.29/31.23)	DDSWKHIcLRLgKAGSMS..W..DVRI
  981- 1005 (32.51/19.38)	DPHFKEL.WEL.NAGSTTtpWgaGVRI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.00|      15|      15|     749|     763|      11
---------------------------------------------------------------------------
  749-  763 (23.77/13.07)	SSAIKLSGSKSNRDL
  767-  781 (25.22/14.38)	SSPSEHGSADGNNTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     137.74|      37|     402|    1253|    1296|      12
---------------------------------------------------------------------------
  930-  954 (24.72/ 6.10)	SRAIPYVEEVGMRSPssnLWL....RLPF...................
 1256- 1296 (60.97/60.46)	SSLLPFDVSVVLRGP...YWI....RIIYrkkFSVDmRCFAGDQVWLQ
 1664- 1699 (52.05/33.38)	...LPYCVSVRLR.....YSFgdnsHISF...LAMD.GSHGGRACWLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.64|      16|      18|    1343|    1359|      13
---------------------------------------------------------------------------
 1343- 1359 (23.95/17.85)	PHLNTSAPQSAAsANRL
 1363- 1378 (30.69/18.46)	PGVHMSRPTSGV.ANQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.63|      15|      15|     609|     623|      14
---------------------------------------------------------------------------
  609-  623 (26.79/20.67)	QMHIMK.YENSTNLFD
  625-  640 (21.84/15.29)	KLHTLQsIESCDDMMD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     101.98|      30|    1112|     500|     529|      15
---------------------------------------------------------------------------
  500-  529 (50.60/32.67)	GSATATEVFSSLRTRSILHLFAATGSFFGL
 1614- 1643 (51.38/33.29)	GSASDDNTESSLAKSNIHHDRAHSSVEFAL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05476 with Med14 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HLQSTNTFSSSPVRNSSAIKLSGSKSNRDLSSLSSPSEHGSADGNNTLQLIPSSKVNSNQNPGQSSYSGGLRNS
734
807










Molecular Recognition Features






MoRF SequenceStartStop




NANANA