<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05475

Description Uncharacterized protein
SequenceMAIQEEGERAGSADAPLTVGLALGGSKSSTYVLQWALAKFASGKDKDENKSAPTFKLIHVLTPVLTVPTPLGNYPVDKVRPEIADTHAKEVQVQAQEMLLQCRNMCDENKVEVEVLLVKGNDVGDAISNLVAQYQIQVLVVGNTTSRKSSRNKTSSKICKSVPSSCTTYIVSKDGLSSVYSPGLGSDTSDSQVHSGEMSPRSDLNDSSGRTLLGLPSLPRSNLASENLKSSSSSKHDGSFTLYDYLSGSASVYADQDRTITSCTDGESSISSKVQASDKVPTQGSSLQALMLSDKVPTQKNSLQGLMLSDSKDDVNTELEKLRLELRHIQGTYKLVQDESVDASHQVVELAAMRVEGKAQLRDIQSRVDKANDEVQEDKAHRCATEEVVTHFKDLVRAEVMQKNRLLIKASKDADQKSRLEELFVLRGNLYSTFTWEEIDNATSSFSESHKIGTGSNGTVYKGHLKHLDVAIKILHSDDSSSTKHFNQELDVLRRIRHPHLLMLLGALPDRGCLVYEYMENGSLADRLQCINGTQPIPWFHRFCIAWEIVSALVFLHSTKPNPIIHRDLKPENVLLDRNLVSKIGDVGLSTLVPLKDSSSSGTMYKNTGLAGTLFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDGQLMDVLDGSAGNWPAKEAYDLAHLGLSCLEMRSKDRPDLKNMVAVELERLKNIAGAASEPVPGPPSHFVCPILKEVMQDPCIAADGHTYERNAILMWLSKHELSPVTKALLPNKTLVSNHSLLSAISSWRSQGGGL
Length799
PositionTail
OrganismBrachypodium distachyon (Purple false brome) (Trachynia distachya)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Brachypodieae> Brachypodium.
Aromaticity0.05
Grand average of hydropathy-0.315
Instability index39.27
Isoelectric point6.03
Molecular weight87409.09
Publications
PubMed=20148030

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05475
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     196.43|      51|      51|     146|     196|       1
---------------------------------------------------------------------------
  146-  195 (80.61/44.81)	...SRKSSRNKTSSKICKSVPSSCTTY......IVS.KDGLSSVYSPGLGSDTSDSQVHS
  196-  237 (58.76/30.69)	GemSPRSDLNDSSGRTLLGLPSLPRSN......LAS.EN.LKS..........SSSSKHD
  238-  286 (57.06/29.59)	G...........SFTLYDYLSGSASVYadqdrtITScTDGESSISSKVQASDKVPTQGSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     166.10|      53|     289|      76|     130|       2
---------------------------------------------------------------------------
   76-  130 (81.78/62.02)	VDKVRPEIADTHAKevQVQAQEMLLQCRNMCDENKVEVEVLLVKGNDVGDAISNL
  368-  420 (84.33/57.88)	VDKANDEVQEDKAH..RCATEEVVTHFKDLVRAEVMQKNRLLIKASKDADQKSRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.89|      26|     138|     508|     536|       3
---------------------------------------------------------------------------
  508-  536 (43.98/38.56)	LPDrgcLVYEYMENGSLADRLQCINGTQP
  652-  677 (47.91/31.63)	LPE...LVERAVEDGQLMDVLDGSAGNWP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.84|      26|     138|     326|     354|       4
---------------------------------------------------------------------------
  304-  329 (31.47/15.94)	QG...LMLSDSKD...DVnTELEKL.R....leLRHI
  330-  364 (32.50/24.58)	QGtykLVQDESVDASHQV.VELAAM.RvegkaqLRDI
  478-  498 (19.86/ 6.80)	........DDSSSTKHFN.QELDVLrR......IRH.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.51|      14|     143|     456|     469|       6
---------------------------------------------------------------------------
  456-  469 (27.68/19.89)	SNGTVYK.....GHLKHLD
  600-  618 (21.83/14.09)	SSGTMYKntglaGTLFYID
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05475 with Med32 domain of Kingdom Viridiplantae

Unable to open file!