<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05467

Description Uncharacterized protein
SequenceMASSSSSTGGDPQAKPVAVAVAVRGDGRASRRAARWAAANLALVPGRVVLVHVIPPVSFVPSPSGERVPVERMEPGVVEMYAQDRRERAQEVFLPFRRFCGRRSVETVVLEGDSVSEALARYAAESGVRNLVLGSACLSWFRRILRLQNLPTTVLKATPCSCNVFIVSRRQLTVKFANLSQTGSRKTPGRAGDKEFDAIGQLKEFPCVSLSSTEGPKPIDDVAKLRKELQNTLMTYGEAHEDVVHAKKKIQVLSNDCSEDLKEVQDALRREELLKQTAAYEKSKHFRAITDTEMVKEAFTCEAYSKHKTESVANMMSTETGKVVDALLCTGKTCRRYLRHEIELATDNFSDAKKIGEGGYGIVYRCTLDHTEVAVKVIQQDSSDKIDEFFKEVEILSQLHHPNLVLLLGFCPEIGCLVYEYMENGSLEDQLINNKGCQPLHWFMRFQIIFEVARGLAFLHGTKPEPIVHRDLKPGNILLDKNYVSKIGDVGFAKLIADLVPDGFTEYRDTVIAGTLYYMDPEYQLTGTVRPKSDLFALGIIVLQLLTGKHPHGLILSAEEAIRKDTFSDILDQSQTDWPIAEAETLAKLGLRCTALKCRDRPNLESEVLPVLEDLLSRVTSSLKSRSPNVVVPSHFVCPILQEVMDDPYVAADGHTYEYRAIKAWLKKHKISPVTKHKLPNSSIIPSHSLHAAIQRWKSQSS
Length702
PositionTail
OrganismBrachypodium distachyon (Purple false brome) (Trachynia distachya)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Brachypodieae> Brachypodium.
Aromaticity0.07
Grand average of hydropathy-0.230
Instability index47.42
Isoelectric point7.83
Molecular weight78166.83
Publications
PubMed=20148030

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05467
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     160.55|      42|      42|     192|     233|       1
---------------------------------------------------------------------------
  141-  180 (46.39/26.49)	....FRRILRLQNLPTTVLKATPCSCNVFIVSRrqLTVKFANLS
  192-  233 (68.39/42.24)	GDKEFDAIGQLKEFPCVSLSSTEGPKPIDDVAK..LRKELQNTL
  237-  271 (45.77/26.04)	GEAHEDVVHAKKKIQVLSNDCSEDLKEVQDA....LRRE.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      66.42|      29|     215|     321|     351|       2
---------------------------------------------------------------------------
  321-  335 (10.12/ 7.48)	.................................GKVvdALLCTGKTCR
  336-  351 (18.99/ 7.42)	RYLRHEIELATDNFSD................................
  554-  599 (37.30/22.46)	LILSAEEAIRKDTFSDildqsqtdwpiaeaetlAKL..GLRCTALKCR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05467 with Med32 domain of Kingdom Viridiplantae

Unable to open file!