<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05462
| Description |
Uncharacterized protein |
| Sequence | MDQHHPPQYGDPYRALVPSPQPDHLHALQYQQPQPQQVTPLPQQQHHSSLASHFHLLHLVTRLGDAIGTGTRDQTFDALVEELTSQFARCQQLLNSISGTLSSKSILLALANTTKRLI |
| Length | 118 |
| Position | Middle |
| Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.474 |
| Instability index | 46.15 |
| Isoelectric point | 6.74 |
| Molecular weight | 13173.68 |
| Publications | PubMed=20148030
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05462
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.20| 17| 19| 5| 23| 1
---------------------------------------------------------------------------
5- 21 (35.32/16.25) HPPQYGDPY.RALVPSPQ
26- 43 (28.89/ 7.80) HALQYQQPQpQQVTPLPQ
---------------------------------------------------------------------------
|