<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05453
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MVQPTARPPRRLSPAEAAQIPSTSLPIGAQISHLIHDFTDLSLDLFTILSSPSTSSAGTRPTAPIYDQLAAVDDKLARLLVLYDAHQAHQQRVDALVAQLGTLDAAWHASASTLRECTQSLAPVVESGALDRAAILAASRAGPALSPSSLLQYARLLAPFTSAPPSSLYPPEDKLDLRGVGATDPTGRSLPPGAIPPFPTDAVMRRGRLQFGREGLLHGLGETNEVGARREGAEGGAAEQASRPDAAARLEQEAKAHEATRAGAAPFEGGAAGAAGDTDDDEFDFDLDLNPDL |
| Length | 293 |
| Position | Middle |
| Organism | Rhodotorula graminis (strain WP1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.231 |
| Instability index | 50.30 |
| Isoelectric point | 4.85 |
| Molecular weight | 30584.70 |
| Publications | PubMed=26441909
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05453
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.26| 12| 31| 234| 245| 1
---------------------------------------------------------------------------
234- 245 (22.85/11.38) EGGAAEQASRPD
268- 279 (22.41/11.03) EGGAAGAAGDTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.63| 22| 25| 158| 179| 2
---------------------------------------------------------------------------
158- 179 (43.30/21.24) A..PF.TSAPPSSLYP.PEDKLDLRG
182- 207 (28.33/11.60) AtdPTgRSLPPGAIPPfPTDAVMRRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.37| 16| 29| 21| 49| 3
---------------------------------------------------------------------------
21- 37 (25.97/26.91) PSTSlPIGAQISHLIHD
52- 67 (30.40/ 7.49) PSTS.SAGTRPTAPIYD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.65| 15| 168| 77| 95| 5
---------------------------------------------------------------------------
72- 88 (21.24/17.77) VDDklARLLVLYDAHQA
93- 109 (22.41/ 7.40) VDAlvAQLGTLDAAWHA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.93| 17| 24| 111| 133| 6
---------------------------------------------------------------------------
111- 133 (19.52/22.75) AStlrECTQSLAPvveSGALDRA
138- 154 (29.41/15.18) AS...RAGPALSP...SSLLQYA
---------------------------------------------------------------------------
|