<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05439
| Description |
Mediator of RNA polymerase II transcription subunit 29-like |
| Sequence | MPNVMRIASLNLAHNTAIDNGIKSSDAAVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKSQPQGML |
| Length | 125 |
| Position | Tail |
| Organism | Scleropages formosus (Asian bonytongue) (Osteoglossum formosum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Osteoglossocephala>
Osteoglossomorpha> Osteoglossiformes> Osteoglossidae> Scleropages.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.210 |
| Instability index | 55.24 |
| Isoelectric point | 6.26 |
| Molecular weight | 13736.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05439
No repeats found
No repeats found
|