<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05434
Description |
Mediator of RNA polymerase II transcription subunit 28-like (Fragment) |
Sequence | PSVPHPPGAPGAPGQPGLMPGPSGSRCQSGNTLVDDLEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKELLIQKHLQRIHHWQQVLEDINVQHKKPTELPQGPLAFLEQASANIPAPMKQN |
Length | 167 |
Position | Head |
Organism | Scleropages formosus (Asian bonytongue) (Osteoglossum formosum) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Osteoglossocephala>
Osteoglossomorpha> Osteoglossiformes> Osteoglossidae> Scleropages.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.588 |
Instability index | 60.55 |
Isoelectric point | 5.52 |
Molecular weight | 18610.84 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.48| 24| 30| 79| 104| 1
---------------------------------------------------------------------------
79- 104 (33.17/26.38) QTECFFLQKRLQlSVQKPEQVVkEDV
112- 135 (43.31/25.12) QRKELLIQKHLQ.RIHHWQQVL.EDI
---------------------------------------------------------------------------
|