| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MATLGLDDDELKALEQTLARLAQLSSSIQSLKMDLIKSNPLPPPSSLQASAQILQRNLQTVLDNLSENSDILTRMAIRPSTNYPGRTQENVLLQLLRKKLEPDVEELVAEGRDTARLATPAGIEDLQDIWHELREWTHGRIAAYVRDEAGDVYTAEERAAGTENVRTGLRRDVEDEDEDEDESEDEEDETDRGDGIEGESAAAQLARGPEPETLLWFMARGDFEMPRNIEYERKVGVKKGLEGVNIPPQPAQAPA |
| Length | 255 |
| Position | Head |
| Organism | Neonectria ditissima |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Neonectria. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.715 |
| Instability index | 60.14 |
| Isoelectric point | 4.39 |
| Molecular weight | 28383.07 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.69| 21| 21| 170| 190| 2
---------------------------------------------------------------------------
146- 167 (27.93/12.42) RDE.AGDVYTAEERAAGTENvRT
170- 190 (33.01/15.87) RRD.VEDEDEDEDESEDEED.ET
192- 213 (29.75/13.65) RGDgIEGESAAAQLARGPEP.ET
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LARGPEPETLLWFMARGDFE 2) RNIEYERKV | 205 227 | 224 235 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab