<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05416
| Description |
Mediator of RNA polymerase II transcription subunit |
| Sequence | MADHSNKLDIVQATAALKSLRSLRNNVGTLFHSLAEGIGLQSGQDSKESKFVAELQQQLVIVQTGVKEFEEAITSVDSVQVQLGNSGYLNQDCTPDALNLYESLITSYRWTDNLAEYSGYATTLLSQNSLKRSTLIPAKRRRIQPSSQNVPPQQIDNVINSLCRSLGDNMKIETFRPYGSSTVLQITLGKIMKGIVVLKRLMVEWVVVKGATEDLMTEDGKIDMWGESRYKVFKKVTENANAAMLHFYSPAYPDLAIRSFLTWFNSYQSLFTSPCKKCGHHLHNLLPPTWRDLRNLDPYHEDCKP |
| Length | 305 |
| Position | Tail |
| Organism | Daphnia magna |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.336 |
| Instability index | 49.55 |
| Isoelectric point | 8.18 |
| Molecular weight | 34363.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05416
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.68| 14| 26| 262| 276| 1
---------------------------------------------------------------------------
262- 276 (23.97/16.44) TWfNSYQSL..FTSPCK
289- 304 (23.71/11.50) TW.RDLRNLdpYHEDCK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.19| 20| 30| 69| 88| 4
---------------------------------------------------------------------------
69- 88 (33.99/17.11) FEEAITSVDSVQVQLGNSGY
101- 120 (37.20/19.20) YESLITSYRWTDNLAEYSGY
---------------------------------------------------------------------------
|