Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQREEKQLDAALEALLQRINDLKTSIRTLLFRLENEYASLSWPSFLDSYAVISGQMNTLLKVMKNDKTPLLRNLIVLPLVLSPDPDEELKQATEGRVVAFSHDITPDMLRTKPDPDVEQRQNQFEQRASQVPPETAQKQINALNKVVNHVLEQITHSREDWENEATVRAAAAQTCVTADTHTLIAAVGLGKNLKTLPIAAPAQPGPGRAQAGPAPGKTTSTIKTTIKAASQVHPYNR |
Length | 237 |
Position | Head |
Organism | Daphnia magna |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.445 |
Instability index | 30.44 |
Isoelectric point | 6.98 |
Molecular weight | 26168.48 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05413 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.46| 14| 27| 78| 91| 1 --------------------------------------------------------------------------- 78- 91 (26.74/15.71) PLVL..SPDPDEELKQ 106- 121 (23.72/13.26) PDMLrtKPDPDVEQRQ --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) KTLPIAAPAQPGPGRAQAGPAPGKTTSTIKTTIKAASQVHPYNR 2) MLRTKPDPDVEQRQNQFEQRASQVPPETAQKQINA | 194 108 | 237 142 |
MoRF Sequence | Start | Stop |
1) TTIKAASQVHPYN | 224 | 236 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab