Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MGDSKDNLLWISWHDSAWIPILNPTNVMDYFQSTTNPFYDRTCNNEIVKMQRLNMEHLSNLTGLEYMLLHVQEPILYVIRKQHRHSVSAVTPLADFYIIAGVVYQAPDLGSVINSRISTTVNHLQGAFDEARTYSRYHPSKGYWWEFKETESKDLEDENKKSQKKSSKDKAKEESSSAFQRHRVNILLADLAKKFPIKNTPFPASNTHLPEQRTSVEDNSKVEVKVEVKTEPQGHKPPPEKKPRLG |
Length | 246 |
Position | Head |
Organism | Daphnia magna |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.757 |
Instability index | 46.57 |
Isoelectric point | 8.45 |
Molecular weight | 28364.71 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05412 No repeats found No repeats found |
IDR Sequence | Start | Stop |
1) NTPFPASNTHLPEQRTSVEDNSKVEVKVEVKTEPQGHKPPPEKKPRLG | 199 | 246 |
MoRF Sequence | Start | Stop |
1) HKPPPEKKPRLG 2) ILLADLAKKFPIK | 235 186 | 246 198 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab