<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05405
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MASESDDWKTPEFRQKFIDTIEEAIRQWGNPTTRTASEMELYSFERANNKEDYLNYHVWLMTHIQGLSEQNPKTTSLAIDSVGTQSNAQPNESVQDDDWKSPGFRQNVIAKIEGAIWISGNPTTKTASEMENHFFEKSTSKEDYLSHLARLLVHIKQLSAQFQAFRQRAQVVPVVNVAAPQRTIKPKTPSQQGVKEKAKGTSAGTVAVAQVNVQPKNVSQQDEWKTPGFRQNVIAKIGAVIRQSGNPTTKSASDMEFHFFQRSKNKEEYLNNLARLLVHIKGLTNVVVGNPADNEY |
Length | 296 |
Position | Tail |
Organism | Daphnia magna |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.700 |
Instability index | 39.31 |
Isoelectric point | 8.59 |
Molecular weight | 33347.90 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05405
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 431.14| 92| 124| 65| 158| 1
---------------------------------------------------------------------------
6- 63 (88.30/51.59) ................................DDWKTPEFRQKFIDTIEEAIrqW..GNPTTRTASEMELYSFERANNKEDYLNYHVWLMTH....
65- 158 (169.31/114.69) QGLSEQnPKTTSLAIDSVgTQSNAQPNESVQDDDWKSPGFRQNVIAKIEGAI..WISGNPTTKTASEMENHFFEKSTSKEDYLSHLARLLVHIKQL
192- 283 (173.54/108.89) QGVKEK.AKGTSAGTVAV.AQVNVQPKNVSQQDEWKTPGFRQNVIAKIGAVI..RQSGNPTTKSASDMEFHFFQRSKNKEEYLNNLARLLVHIKGL
---------------------------------------------------------------------------
|