<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05401
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MLSPNALRQPTPLSPSPSPEPPSGAANGTAAGNGHSSGQALSAATHPGQAQNDVSSTVSSPHEQARQTLENCAKNAIAELYQLAVCTADVQPGQEHVVGARINQVIASLSSLSEAGSNQDLSMLIEPDVMNMLDRGRNPDLHTRTFMSELIIHNQIVASTTMALDSYYDRLADSVARSFPELAEDVEGLRQIPEQSQVSVEGQDLAHDGEGNRPA |
Length | 215 |
Position | Middle |
Organism | Ceraceosorus bombacis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Ceraceosorales> Ceraceosoraceae> Ceraceosorus.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.431 |
Instability index | 54.65 |
Isoelectric point | 4.62 |
Molecular weight | 22714.73 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05401
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.20| 10| 26| 181| 190| 1
---------------------------------------------------------------------------
181- 190 (17.55/11.07) ELAEDVEGLR
204- 213 (19.65/13.14) DLAHDGEGNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.42| 26| 26| 14| 39| 2
---------------------------------------------------------------------------
14- 39 (45.47/21.49) SPSPSPEPPSGAANGTAAGNGHSSGQ
42- 67 (42.95/19.96) SAATHPGQAQNDVSSTVSSPHEQARQ
---------------------------------------------------------------------------
|