Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSNTPVLEASSSQSGGAQERSLAEQYHRAVNQHRFTSDLETLSALASPHYLVHLSQSGHLADPTFIRYLQHLHTTWRKPEYARFLRYPNALYFLDALQHPEFRAAVGTEAWARDTAARVEGHWEHWLSSNSTLDSTKAKQERPT |
Length | 144 |
Position | Middle |
Organism | Ceraceosorus bombacis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Ceraceosorales> Ceraceosoraceae> Ceraceosorus. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.689 |
Instability index | 49.79 |
Isoelectric point | 6.79 |
Molecular weight | 16441.96 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05398 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 103.29| 31| 37| 32| 67| 1 --------------------------------------------------------------------------- 32- 65 (51.61/36.75) QHRFTS..DLETLSALASPHYLVHLSQSGHladPTF 70- 102 (51.68/24.95) QHLHTTwrKPEYARFLRYPNALYFLDALQH...PEF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MSNTPVLEASS 2) PTFIRY 3) TKAKQERP | 1 63 136 | 11 68 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab