<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05393
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MGGSIREEMEVVLHEHRYLVTKLLESLYTASLPPSTTITATRLRTVNEIFNKVLEKDRDLLVTVKKLARHQVTQKELLRIEAEIKGKEQKVIQYAAQLRQSQENIANVLKKHQVVLQNAKRQVQVKLDPRNVIAYAHRIAGTTSAPKEWQPGFPMFGFMPPAPQEHMMRAGVLSRGIVAEIVTQGPEKYTSSTARVKQEGEKETIEKLEIPIGLGASDAQIRKQMPPGWRPGDPVDLPLDALLHYMGRPFFIEHGITLPESWKTGDPLPSDAMEILRKKFKLPEKRVPLYDDEIVDDVDTLRKKRKVEERDTGSAESESSSESGDSEDDAPNTISLSLSSSEDSDEDSD |
| Length | 349 |
| Position | Middle |
| Organism | Plasmopara halstedii |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae>
Plasmopara.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.608 |
| Instability index | 53.82 |
| Isoelectric point | 5.76 |
| Molecular weight | 39253.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.09| 15| 23| 271| 285| 1
---------------------------------------------------------------------------
240- 261 (15.67/ 7.32) DAlLHYMGRPFfiehgiTLPES
271- 285 (26.40/17.09) DA.MEILRKKF......KLPEK
296- 310 (23.02/14.01) DD.VDTLRKKR......KVEER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.90| 31| 39| 67| 98| 2
---------------------------------------------------------------------------
67- 98 (45.34/34.16) LARHQVTQKELLRiEAEIKGKEQKVIQYAAQL
109- 139 (51.57/34.31) LKKHQVVLQNAKR.QVQVKLDPRNVIAYAHRI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.07| 8| 30| 229| 238| 3
---------------------------------------------------------------------------
229- 238 (15.66/13.28) WRPGDPvdLP
262- 269 (19.42/ 9.59) WKTGDP..LP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.32| 13| 16| 317| 329| 4
---------------------------------------------------------------------------
317- 329 (23.06/14.24) SESSSESGDSEDD
335- 347 (22.26/13.53) SLSLSSSEDSDED
---------------------------------------------------------------------------
|