Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MGGSIREEMEVVLHEHRYLVTKLLESLYTASLPPSTTITATRLRTVNEIFNKVLEKDRDLLVTVKKLARHQVTQKELLRIEAEIKGKEQKVIQYAAQLRQSQENIANVLKKHQVVLQNAKRQVQVKLDPRNVIAYAHRIAGTTSAPKEWQPGFPMFGFMPPAPQEHMMRAGVLSRGIVAEIVTQGPEKYTSSTARVKQEGEKETIEKLEIPIGLGASDAQIRKQMPPGWRPGDPVDLPLDALLHYMGRPFFIEHGITLPESWKTGDPLPSDAMEILRKKFKLPEKRVPLYDDEIVDDVDTLRKKRKVEERDTGSAESESSSESGDSEDDAPNTISLSLSSSEDSDEDSD |
Length | 349 |
Position | Middle |
Organism | Plasmopara halstedii |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Plasmopara. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.608 |
Instability index | 53.82 |
Isoelectric point | 5.76 |
Molecular weight | 39253.17 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05393 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 65.09| 15| 23| 271| 285| 1 --------------------------------------------------------------------------- 240- 261 (15.67/ 7.32) DAlLHYMGRPFfiehgiTLPES 271- 285 (26.40/17.09) DA.MEILRKKF......KLPEK 296- 310 (23.02/14.01) DD.VDTLRKKR......KVEER --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.90| 31| 39| 67| 98| 2 --------------------------------------------------------------------------- 67- 98 (45.34/34.16) LARHQVTQKELLRiEAEIKGKEQKVIQYAAQL 109- 139 (51.57/34.31) LKKHQVVLQNAKR.QVQVKLDPRNVIAYAHRI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.07| 8| 30| 229| 238| 3 --------------------------------------------------------------------------- 229- 238 (15.66/13.28) WRPGDPvdLP 262- 269 (19.42/ 9.59) WKTGDP..LP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.32| 13| 16| 317| 329| 4 --------------------------------------------------------------------------- 317- 329 (23.06/14.24) SESSSESGDSEDD 335- 347 (22.26/13.53) SLSLSSSEDSDED --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSEDDAPNTISLSLSSSEDSDEDSD 2) MEILRKKFKLPE | 325 273 | 349 284 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab