<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05393

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMGGSIREEMEVVLHEHRYLVTKLLESLYTASLPPSTTITATRLRTVNEIFNKVLEKDRDLLVTVKKLARHQVTQKELLRIEAEIKGKEQKVIQYAAQLRQSQENIANVLKKHQVVLQNAKRQVQVKLDPRNVIAYAHRIAGTTSAPKEWQPGFPMFGFMPPAPQEHMMRAGVLSRGIVAEIVTQGPEKYTSSTARVKQEGEKETIEKLEIPIGLGASDAQIRKQMPPGWRPGDPVDLPLDALLHYMGRPFFIEHGITLPESWKTGDPLPSDAMEILRKKFKLPEKRVPLYDDEIVDDVDTLRKKRKVEERDTGSAESESSSESGDSEDDAPNTISLSLSSSEDSDEDSD
Length349
PositionMiddle
OrganismPlasmopara halstedii
KingdomOomycetes
LineageEukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Plasmopara.
Aromaticity0.05
Grand average of hydropathy-0.608
Instability index53.82
Isoelectric point5.76
Molecular weight39253.17
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      65.09|      15|      23|     271|     285|       1
---------------------------------------------------------------------------
  240-  261 (15.67/ 7.32)	DAlLHYMGRPFfiehgiTLPES
  271-  285 (26.40/17.09)	DA.MEILRKKF......KLPEK
  296-  310 (23.02/14.01)	DD.VDTLRKKR......KVEER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.90|      31|      39|      67|      98|       2
---------------------------------------------------------------------------
   67-   98 (45.34/34.16)	LARHQVTQKELLRiEAEIKGKEQKVIQYAAQL
  109-  139 (51.57/34.31)	LKKHQVVLQNAKR.QVQVKLDPRNVIAYAHRI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.07|       8|      30|     229|     238|       3
---------------------------------------------------------------------------
  229-  238 (15.66/13.28)	WRPGDPvdLP
  262-  269 (19.42/ 9.59)	WKTGDP..LP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.32|      13|      16|     317|     329|       4
---------------------------------------------------------------------------
  317-  329 (23.06/14.24)	SESSSESGDSEDD
  335-  347 (22.26/13.53)	SLSLSSSEDSDED
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05393 with Med4 domain of Kingdom Oomycetes
Unable to open file!