<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05389
| Description |
Os10g0548400 protein (Fragment) |
| Sequence | SGPRICGPRGIFFFLTLLVWEFDTVTSRGQVGGESRRRRRWSVSGRSRRRRGEMEATVDELSEAYQEFVAAAAAVVEARGQSGGEKNAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGASSSSSAALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGASAAGPGGGGGAAAAASGVAGQHGHGGVDTRFPEDGAQ |
| Length | 213 |
| Position | Tail |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.262 |
| Instability index | 63.03 |
| Isoelectric point | 6.44 |
| Molecular weight | 22294.54 |
| Publications | PubMed=16100779
PubMed=24280374
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05389
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.77| 24| 114| 70| 93| 1
---------------------------------------------------------------------------
25- 42 (24.40/ 9.66) ........VTSRGQVGGESRRRRRWS
70- 93 (39.01/19.50) AAAAA..VVEARGQSGGEKNAATDAA
187- 212 (36.36/17.72) AAAAAsgVAGQHGHGGVDTRFPEDGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.89| 18| 35| 127| 146| 2
---------------------------------------------------------------------------
127- 146 (25.48/16.42) LVDEATGASSSSSAalAAPG
165- 182 (32.41/15.81) LVIELQHGAGGASA..AGPG
---------------------------------------------------------------------------
|