<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05379
| Description |
Os07g0211101 protein |
| Sequence | MAAPSAAAAWVDWAAEYTKAAQAESRPPAEWAARVASVVAAAGDAPWSPGLAEMLARALLYGGGGAAWKYAEAALAAGLASPALLLAILSTRVIPHRFTRPTAYRLYLELLRRHGFNFAFQMKAANFKK |
| Length | 129 |
| Position | Tail |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.191 |
| Instability index | 32.90 |
| Isoelectric point | 9.99 |
| Molecular weight | 13729.71 |
| Publications | PubMed=16100779
PubMed=24280374
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05379
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.46| 13| 32| 41| 56| 1
---------------------------------------------------------------------------
7- 19 (22.13/ 6.17) AAAWVDWA...AEYTK
41- 56 (20.33/11.12) AAGDAPWSpglAEMLA
---------------------------------------------------------------------------
|