<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05372
Description |
Os03g0641700 protein (Fragment) |
Sequence | MSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRS |
Length | 159 |
Position | Head |
Organism | Oryza sativa subsp. japonica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -1.094 |
Instability index | 26.34 |
Isoelectric point | 9.66 |
Molecular weight | 18285.64 |
Publications | PubMed=16100779
PubMed=24280374
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05372
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.71| 15| 20| 74| 92| 1
---------------------------------------------------------------------------
74- 92 (23.01/27.29) LFQDAYLREKTsyiqPFDM
95- 109 (26.69/18.48) LGQAFQLRETA....PIDL
---------------------------------------------------------------------------
|