<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05361

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMENGGLNGALTNHDRYSKLNGVNGAGTEGQQNAADKGKVAFGGDSGGIAVNGNGPETNGPRQQQPPSAHELIETPRMNDLPDEIVHITQGFIPISLLLTRLAQTTHNSLQDKIADLAKMPVPANALNGNSLLPANVPDDSSNENLRKKSAILNFTQDMHAKWIKALVITEWSRKSEMVSKLIDLKFHIDQQRILFDAALDNIVNVKRDLTFARMPSPDLKTALQVLSTGKAHWMPDLQYIEPPPLTSDEQIKWMNDLNTLLSLRLNLEDFDKIPYHFRNYEIDSGRVTFRVPGEFEVDLTIADEDFEKQFWFIDFRFIFTPSAAALPESLKNYLEAYVNDVLSKDGLAGCYQFLHEFVLTHKLNELKRQAIQLSKNAWTGTLIVEPLNRALAIQYWTSRTPPNTHKSWVLIAVNSGRKQTGHPNPKESSYLTAKWYRDNKEVKDVVIPLDVENLSAETLLRTVVGRHIDYNLSSIHNKLQEAPRFLNREAGMVLHISQSDPGASSLTMHVGYSDSASLLMEPTTGLFAVKPHSKFTIQYEHQLNNGKNPEEDGVSCLENVRCGFMEDELNRRGSTMGWNSKKCPLNSEELRSVVKTKKWTRTIWLQRDGWGPNWNRDIPNHASRFQARLPLNKGHPDLCDAFWNNLTLFATGMIAQSVDMRELHRNHIKSRPNGSRNWALPQQVRLPSIEIALSGIFPTMVLDTVEKDISKESNEQADTVGEDTELASIVRPPTGLGVIPSTQQPWANDIVAIRFKEVQPPRRTPTPHEGATSDSPLMCVSDAIIRVRKPGKFAALKGMVDRDVSYNPQKGEFCLRIRHGIGQSLLSTLKSRVKAVDRFVNFLESMDKAKGTIQSESVTLRQVVFSYTEPAQDSDGDVMEPTQRWKVLLDLSKDNIDVRLERGNPHLRVVDLMQSLVNSEGGIEALMVWLPVSLPALGGIERIETAWTGIQARLQGQVEFSMKTIDWMSIRYTLAAPSGVFQQPKRQVTLEVRMKVRRGEPWWHIWRSDSGIGPPPEDEYTAALKPIWEGRGEDWHGLTSSAAARPNKGVVNLLTAIDGAIRPLAGVSVGRDGGSKVVVID
Length1081
PositionTail
OrganismNeonectria ditissima
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Neonectria.
Aromaticity0.07
Grand average of hydropathy-0.424
Instability index41.04
Isoelectric point6.65
Molecular weight121011.09
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05361
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.84|      26|      29|     937|     963|       2
---------------------------------------------------------------------------
  921-  935 (22.79/13.04)	.GGIEAL.MVWLPV......................SLP
  937-  963 (42.11/36.97)	LGGIERIeTAWTGI............QARLQGQVEFSMK
  965-  995 (24.93/15.07)	ID........WMSIrytlaapsgvfqQPKRQVTLEVRMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.93|      16|      29|      78|      93|       3
---------------------------------------------------------------------------
   78-   93 (29.32/19.51)	NDLPDEIVHITQGFIP
  107-  122 (27.61/17.92)	NSLQDKIADLAKMPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.86|      12|      29|    1003|    1014|       4
---------------------------------------------------------------------------
 1003- 1014 (26.02/17.09)	WHIWRSDSGIGP
 1035- 1046 (22.84/14.02)	WHGLTSSAAARP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.94|      16|      35|     569|     584|       5
---------------------------------------------------------------------------
  569-  584 (30.52/15.99)	LNRRGSTMGWNSKKCP
  590-  604 (25.11/11.89)	LRSVVKTKKW.TRTIW
  605-  619 (31.31/16.59)	LQRDGWGPNWN.RDIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.48|      18|      19|     217|     234|       6
---------------------------------------------------------------------------
  217-  234 (32.87/18.16)	PDLK..TALQVLSTGKAHWM
  235-  254 (29.61/15.67)	PDLQyiEPPPLTSDEQIKWM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.92|      11|      19|     402|     412|       8
---------------------------------------------------------------------------
  402-  412 (21.47/13.79)	PNTHKSWVLIA
  423-  433 (20.45/12.76)	PNPKESSYLTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.12|      10|      37|     268|     277|       9
---------------------------------------------------------------------------
  268-  277 (21.68/15.81)	EDFDK....IPYHF
  304-  317 (14.44/ 7.89)	EDFEKqfwfIDFRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.43|      12|      37|     800|     811|      10
---------------------------------------------------------------------------
  800-  811 (23.62/18.82)	VDRDV....SYNPQKG
  836-  851 (16.81/10.92)	VDRFVnfleSMDKAKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.96|      18|      36|       4|      21|      11
---------------------------------------------------------------------------
    4-   21 (32.17/20.24)	GGLNGALTNHDRYSKLNG
   42-   59 (32.80/20.78)	GGDSGGIAVNGNGPETNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.33|      12|     300|     361|     378|      13
---------------------------------------------------------------------------
  361-  378 (12.82/25.03)	HKLNelKRQAIQLsknaW
  385-  396 (23.51/15.47)	EPLN..RALAIQY....W
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05361 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MENGGLNGALTNHDRYSKLNGVNGAGTEGQQNAADKGKVAFGGDSGGIAVNGNGPETNGPRQQQPPSAHELIETPRMND
1
79










Molecular Recognition Features






MoRF SequenceStartStop




NANANA