<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05338
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNLPGGLQVSNPLHVQWNPPWNPNWINASNVLDYFTNTMNPFYDPNCLNEQIRMQRLSPEVLSRSSGVEYALLYACEPLFVIRKQYRQANQTITPLEDYYIIGGTVYQAPDLCSVLNSRLQASINHLRTAFEEVKSYYRFHPAKGYYWQFKNETGIEKKSTKKNRENVLEDVRASLYQRQRMDTLIGDLVNKFPLPLLEEVADSVNLGKESPKKVAPVDKNTKEVAKRDEAEEQKFSSKKMKM |
Length | 243 |
Position | Head |
Organism | Trichuris muris (Mouse whipworm) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.663 |
Instability index | 47.55 |
Isoelectric point | 8.79 |
Molecular weight | 28159.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05338
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.46| 18| 20| 8| 27| 2
---------------------------------------------------------------------------
10- 27 (41.58/27.05) SNPLHV...QWNPPWNPNWIN
29- 49 (31.88/13.76) SNVLDYftnTMNPFYDPNCLN
---------------------------------------------------------------------------
|