<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05332
Description |
Uncharacterized protein |
Sequence | MRENFVEILRLAKVGEETQVHRLTEYEHEQYEMQIRASNMTRSAETLIQTVSDLRQFLILNDFAFINEAVAFTSAQCQLSQKEMNEKLATIKEEISFCLQEAEQEYYCTSLKHYVNHLTANEPEHSHNC |
Length | 129 |
Position | Head |
Organism | Trichuris muris (Mouse whipworm) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.533 |
Instability index | 40.29 |
Isoelectric point | 4.98 |
Molecular weight | 15148.82 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05332
No repeats found
No repeats found
|