<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05321
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | METPKRTNDVLSVKTLINDVLNDLDLICRVVAEFVTVPKEQRRFGSTLKTGVLADLFLLKAAELEDLWRVAAEQTDRQKLIDCIQHDIEVRNEYIDRLRGCLLEAESVLMNAIFQANLKLKSIKQADLRPVSPDDLVRYAHRISAANSVTAPLTWQQGDPERPFPTDMEMRSGWLSRITGSSEFSAPISTLVHPPVMSSHIGSVDGVHSVPLPNQNDVSPVAPPKLGPTSCWPSPRSAYMSSPRARLANACPSPGGVQIGQRTVRTPTVHNQAVKREIGSTVEDAVEALSSDSSSSSSSDSPS |
| Length | 303 |
| Position | Middle |
| Organism | Trichuris muris (Mouse whipworm) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.297 |
| Instability index | 60.97 |
| Isoelectric point | 5.91 |
| Molecular weight | 33101.12 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05321
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.62| 14| 79| 87| 100| 1
---------------------------------------------------------------------------
87- 100 (24.72/14.31) DIEVRNEYIDRLRG
167- 180 (26.90/16.05) DMEMRSGWLSRITG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.02| 13| 29| 15| 27| 2
---------------------------------------------------------------------------
15- 27 (22.26/17.59) TLINDVLNDLDLI
47- 59 (21.75/17.03) TLKTGVLADLFLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.57| 13| 21| 219| 235| 3
---------------------------------------------------------------------------
219- 235 (13.07/18.25) SPVAppKLGpTSCwPSP
242- 254 (25.50/10.74) SPRA..RLA.NAC.PSP
---------------------------------------------------------------------------
|