<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05311
| Description |
Uncharacterized protein |
| Sequence | MAGNFWQSSHWEQWILDKQDILRMRGEDMKCITEEEYTKLMIFFCNFIHAIGMDSQQQHKTRMQVIATACVYFRRFYARRSLKDIDPFLLAPTSLFLASKVEEHGMMSHNKLIQATNNALKRWPFIQQDLMLRVQHIQEAEFFLLEILDCCLIVYHPYRPLNQLMAEIGRDHKDVETIASYAWKICNDCTRTDLSLMYPPHQIAIACILIASIWTNRDRELKNWFAELAVDFEKVLEIQKTIINLYSTWKTFDEKEQLLVILQKIPRPNPGPQSSNVALIQPHPHNSLQVNNMNMHSMGPPPMPPVGNVKFESH |
| Length | 314 |
| Position | Kinase |
| Organism | Thelazia callipaeda (Oriental eyeworm) (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Thelazioidea> Thelaziidae> Thelazia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.257 |
| Instability index | 56.73 |
| Isoelectric point | 6.67 |
| Molecular weight | 36801.34 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.14| 26| 63| 159| 184| 3
---------------------------------------------------------------------------
159- 184 (47.39/34.00) RPLNQLMAEIGRDHKDV.....ETIASY.AWK
219- 250 (36.75/24.89) RELKNWFAELAVDFEKVleiqkTIINLYsTWK
---------------------------------------------------------------------------
|