<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05308
Description |
Uncharacterized protein |
Sequence | MASCEDEVLRIGKKFERMIQGTKSVSFFALPGIRLIRHYFRYIIQMDSAMELLDALSTLPVDINILTKTRIGMTINDLRKKTSDEHIAKRAKALIKEWKVLLAGRTSSNSKNDAKSSLAKNSVSASASNGNSKALSQSSDLQKNISGSANSLVTPAAKKQLLVDEIRNKCATMILDALISKDLPDGTLDPEDLAIRTEKKLFEVHRGTSEKYRAALRSRVFNLRDKKNPALRENVLIGAVTPEKYV |
Length | 246 |
Position | Unknown |
Organism | Thelazia callipaeda (Oriental eyeworm) (Parasitic nematode) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Thelazioidea> Thelaziidae> Thelazia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.336 |
Instability index | 39.45 |
Isoelectric point | 9.80 |
Molecular weight | 27304.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05308
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.86| 19| 19| 109| 127| 1
---------------------------------------------------------------------------
109- 127 (30.46/19.40) NSKNDAKSSLAKNSVSASA
131- 149 (31.40/20.19) NSKALSQSSDLQKNISGSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.05| 16| 18| 186| 203| 3
---------------------------------------------------------------------------
186- 203 (22.15/20.91) GTLDPEDLAIRTekKLFE
207- 222 (26.90/17.97) GTSEKYRAALRS..RVFN
---------------------------------------------------------------------------
|