<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05303

Description Uncharacterized protein
SequenceMDDEEYMKPMLPTVPEKCGPPVIPLGHLIEFAVQQIFHELTVLSELLPKKLDSERKISIVQFAHSTRVLFIKLLAVVKWVKSSKKFESCASICYFLDQQSQYFLDTADRLVQLAREELVFARLPAFQVAAAVDVLTVGTFSRLPACIKNRFISDSLITPKEEASVLSRLNHVIQCRISSFGIKLSPRISKIVIRNGMVTMTVNGEFEVSLTLLGERPTTKWTLLNIKILVEDYEIGFGTKLVHPLQVNMLHNVLQLRMDDSQEPLDEVYSFLHSFAQMLQLDVLYCQATQVFSGSMQQYGIIERYDRDAGVLILNYWLRKTQHNRRLSINRLLSETVGIRCRERLLRIRERLGLLKPPAVVSLTGRAAPTLTYPLLGADSHPDEMLILSVNDFSGNVLAVVRALGFCPELRELEQLFDDRVPLKAIGDKMNRLRILLMLKRYRKAIAPLPVRIVPENVFSARLASLPELPPDRICLQFIKEEIYYLIVSFTSNMESGVDIDMYLVSNVERKLNTVWLHPSQLLTSLPESSCLSPKFESALDPPAKRRCWLGDKRLLTSAVATLDDRLAFMRICEELDRRNVKYKPLTVETTVGGLILHITDISEAVPSGSDDFFSSVINSCLRLDTRTRVIWPFECTMINTPLVADFCEPTIHDGHEFMKTKTTVMEIHGSGGISSPNTSESVSTHMVDRLVVFSHMYDPVKEFAVAYYNYYNKFCHIVAFTYHKLVLAYGLNRNMLMMLSWRTQKAPNSKQYFYLTFGIGPSQRMAASDLANCETLWNPHVFLASRLQERFNKRRSLIDLVQYLIDTIAPLSALHSFTRIRLQSLRAFCQMMCYDAAFAVDLQTTVSIVDEYRIRVIYGHIHLEFLLLSNSRLGLRDCSVGSNCALRLRQFCNNFLSSELRSLNEEKSPSAPSWIATGSGPGSLPSHQMGRSPASRLVSSPMSHMSLSVPPVDSVGSLRHSSDHRSKAPILLDHDALFCMMSVDGSGTCPLDQYLFALTYLSKLGPALEGYRREHRGSGAHPVIQFRQLIITAESIRLSVLGAAPPNLKHEPFLVNMNIYLDDETMSLKMKLDFDGEDVPSESDIRIAELYFVKVVAHLGNEIAVVAFANACRLAAPGAFSAIARIMSVQMNWTEDTPWRPSIQLVMWSQEGSVPRARISPGIVIDQTNISVLILLCLRPTRHNPSEKNADASKHLIPLIYNTQTNTVARRSSGADDDASNATTVLSNVSEQYSLTNEPALWPAIYSLAHNFALQR
Length1257
PositionTail
OrganismThelazia callipaeda (Oriental eyeworm) (Parasitic nematode)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Thelazioidea> Thelaziidae> Thelazia.
Aromaticity0.08
Grand average of hydropathy-0.007
Instability index47.39
Isoelectric point8.03
Molecular weight141677.46
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05303
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.44|      10|      31|     516|     525|       1
---------------------------------------------------------------------------
  516-  525 (20.77/13.19)	WLHPSQLLTS
  549-  558 (19.67/12.06)	WLGDKRLLTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.44|      10|      29|     986|     995|       2
---------------------------------------------------------------------------
  986-  995 (21.35/14.72)	GSGTCPLDQY
 1018- 1027 (20.09/13.36)	GSGAHPVIQF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.06|      23|     145|     785|     836|       3
---------------------------------------------------------------------------
  260-  282 (42.54/12.79)	DSQEPLDEVYSF.......LHSFAQMLQLD
  807-  836 (38.52/ 8.25)	DTIAPLSALHSFtrirlqsLRAFCQMMCYD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.79|      20|     299|     425|     448|       4
---------------------------------------------------------------------------
  425-  448 (22.97/30.14)	AIGdkMNRlRILLMLKrYRKAIAP
  729-  748 (39.82/26.89)	AYG..LNR.NMLMMLS.WRTQKAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.48|      31|      33|     612|     642|       5
---------------------------------------------------------------------------
  612-  642 (57.57/35.12)	DFFSSVINSCLR.LDTRTRVIWPFECTMINTP
  646-  677 (52.91/31.72)	DFCEPTIHDGHEfMKTKTTVMEIHGSGGISSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     122.77|      38|     860|     283|     324|       6
---------------------------------------------------------------------------
  283-  324 (57.35/51.03)	VLYCQATQVFSGSMQQyGIIerYDR.DAGVLILnYWLRKTQHN
 1147- 1185 (65.42/41.03)	VMWSQEGSVPRARISP.GIV..IDQtNISVLIL.LCLRPTRHN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.82|      29|      35|     903|     935|       8
---------------------------------------------------------------------------
  903-  935 (44.81/36.40)	SLNEEKSPSAPSWIATGSGPGSlPSHqmgRSPA
  941-  969 (53.00/29.92)	SPMSHMSLSVPPVDSVGSLRHS.SDH...RSKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.41|      14|      24|     140|     153|       9
---------------------------------------------------------------------------
  140-  153 (26.17/14.57)	FSRLPACIKNRFIS
  166-  179 (25.24/13.82)	LSRLNHVIQCRISS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05303 with Med14 domain of Kingdom Metazoa
Unable to open file!