<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05293

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMSMDQTFRHAAGPDYVDSERKRFEAECEFVQALGNPHYCNFLAQKGYFKEEYFINYLKYLQYFKQPEYAKTIVYPHCLFMLDCLQHKEFREAIGNINHAKYIENQQMLQWQYYYRKRNEYNAKIVQAKEAGALKTSDDVVNLLKELANSDRPKEAESVNKVSEVDESLAEEEDKTTQKEVMRLLKEVREGMKISDDGNVLFEEESDDGDGSEELSTEIKELLEEIEREANDVIDKAFSEEEDAEIEEYDQELKQAPYTQNEDYESYTKEQEINRIQTAFEQVAEYGELTEEELTKNGYPIDVLYDSNIISLALRSKDLSSSDQKSRKYY
Length329
PositionMiddle
OrganismStrongyloides papillosus (Intestinal threadworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides.
Aromaticity0.11
Grand average of hydropathy-0.932
Instability index54.90
Isoelectric point4.52
Molecular weight38670.19
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05293
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     141.06|      37|      38|     171|     207|       1
---------------------------------------------------------------------------
  135-  166 (38.31/21.52)	.....TSDDVVNLLKEL.ANSDRPKEAESVNKVSEVDE
  171-  207 (61.41/38.47)	EEDKTTQKEVMRLLKEV.REGMKISDDGNVLFEEESDD
  212-  242 (41.35/23.75)	EELST...EIKELLEEIeREANDVIDK.A..FSEE.ED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      61.44|      17|      35|     244|     260|       2
---------------------------------------------------------------------------
  244-  260 (29.86/22.29)	EIEEYDQELK..QAPYTQN
  264-  281 (15.22/ 7.01)	ESYTKEQEINriQTAFEQ.
  283-  296 (16.35/ 8.20)	..AEYG.ELT..EEELTKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     118.11|      23|      37|      28|      50|       3
---------------------------------------------------------------------------
    7-   25 (26.06/13.03)	.FRHAAG.PDYVD..SERKRFEA
   28-   50 (43.92/26.28)	EFVQALGNPHYCNFLAQKGYFKE
   52-   71 (31.42/17.01)	YFINYL...KYLQYFKQPEYAKT
   88-  102 (16.72/ 6.11)	EFREAIGNINHAKYI........
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05293 with Med31 domain of Kingdom Metazoa

Unable to open file!