<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05286
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDQNQGTINVSPFPFPPEYAQEYTTENIKSGRFRYPPPIPKKYKLFGIEYDRDNDKEPSLLDLKIPQLYNSKEDIKKELKKLNMSMIAAYLDLLDVLIRCPSDPERIQRIEQLRLLFINFHHLCNQLRPIQARDNLVAICEDQVIDIVRVAESLRQIVRLGKSDTYDLFKKYVKALKDKKDRYYKKKKSLIKEKKLEQVQQKMASEINYPSTDINIENMDEVGSLNNEINTMETCDKDMVFSTSNGVDNVNTSEHQGKESSLIFSRDEQLANIFNSLDIF |
| Length | 280 |
| Position | Middle |
| Organism | Strongyloides papillosus (Intestinal threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.661 |
| Instability index | 40.91 |
| Isoelectric point | 6.05 |
| Molecular weight | 32698.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05286
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.15| 17| 18| 7| 23| 1
---------------------------------------------------------------------------
7- 23 (33.78/19.23) TINV..SPFPFPPEYAQEY
25- 43 (29.37/15.95) TENIksGRFRYPPPIPKKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.51| 18| 18| 220| 237| 2
---------------------------------------------------------------------------
220- 237 (32.88/22.11) DEVGSLNN...EINTMETCDK
238- 258 (27.63/17.64) DMVFSTSNgvdNVNTSEHQGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.84| 14| 18| 50| 65| 3
---------------------------------------------------------------------------
50- 63 (24.72/19.28) YDRDND..KEPSLLDL
69- 84 (19.13/ 6.17) YNSKEDikKELKKLNM
---------------------------------------------------------------------------
|