Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDQNQGTINVSPFPFPPEYAQEYTTENIKSGRFRYPPPIPKKYKLFGIEYDRDNDKEPSLLDLKIPQLYNSKEDIKKELKKLNMSMIAAYLDLLDVLIRCPSDPERIQRIEQLRLLFINFHHLCNQLRPIQARDNLVAICEDQVIDIVRVAESLRQIVRLGKSDTYDLFKKYVKALKDKKDRYYKKKKSLIKEKKLEQVQQKMASEINYPSTDINIENMDEVGSLNNEINTMETCDKDMVFSTSNGVDNVNTSEHQGKESSLIFSRDEQLANIFNSLDIF |
Length | 280 |
Position | Middle |
Organism | Strongyloides papillosus (Intestinal threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.661 |
Instability index | 40.91 |
Isoelectric point | 6.05 |
Molecular weight | 32698.00 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05286 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.15| 17| 18| 7| 23| 1 --------------------------------------------------------------------------- 7- 23 (33.78/19.23) TINV..SPFPFPPEYAQEY 25- 43 (29.37/15.95) TENIksGRFRYPPPIPKKY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.51| 18| 18| 220| 237| 2 --------------------------------------------------------------------------- 220- 237 (32.88/22.11) DEVGSLNN...EINTMETCDK 238- 258 (27.63/17.64) DMVFSTSNgvdNVNTSEHQGK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.84| 14| 18| 50| 65| 3 --------------------------------------------------------------------------- 50- 63 (24.72/19.28) YDRDND..KEPSLLDL 69- 84 (19.13/ 6.17) YNSKEDikKELKKLNM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EYAQEYTTE 2) PIPKKYKLFGIEYDRD | 18 38 | 26 53 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab