Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MEVDEIQPKNPVTIASINETVPTQLTENTLLTTNIDDSNNVSKYNESKKIELAKKLREENKKVGDKFPGFYGVMKKPPNTQKLLGSDDILSIYNLRECFNKVCGKVNEGDSIYSILDEVIGPLENETYKSDSSSLRKLIERPPIVDKEIINFTDQMLKFYDLQPGALDKKYQLEGNAKEIASRYAMECSVNGAKDKSGTNGSHDGVPPINFEMYEKLDSGVRLKKKNRTKEEKEERARRKAERKEKRRLEAEKERFEELNMIKKAKKEEKYIESEKSFTIQTEQEDNEEEITR |
Length | 293 |
Position | Head |
Organism | Strongyloides papillosus (Intestinal threadworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
Aromaticity | 0.06 |
Grand average of hydropathy | -1.030 |
Instability index | 48.48 |
Isoelectric point | 5.72 |
Molecular weight | 33789.77 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05269 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.80| 20| 20| 226| 245| 1 --------------------------------------------------------------------------- 226- 245 (32.77/17.09) KNRTKEEK...EERARRKAERKE 246- 268 (27.03/12.95) KRRLEAEKerfEELNMIKKAKKE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 163.13| 56| 64| 39| 96| 2 --------------------------------------------------------------------------- 39- 96 (87.22/53.85) NNV.SKYNESKKI.....ELAKKLREENKKvGDKfPGFYGVMKKPPNTQK.LLG.SDDILSIYNLR 100- 163 (75.91/39.52) NKVcGKVNEGDSIysildEVIGPLENETYK.SDS.SSLRKLIERPPIVDKeIINfTDQMLKFYDLQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DKFPGFYGV 2) NFEMYEKL | 65 210 | 73 217 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab