| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MEVDEIQPKNPVTIASINETVPTQLTENTLLTTNIDDSNNVSKYNESKKIELAKKLREENKKVGDKFPGFYGVMKKPPNTQKLLGSDDILSIYNLRECFNKVCGKVNEGDSIYSILDEVIGPLENETYKSDSSSLRKLIERPPIVDKEIINFTDQMLKFYDLQPGALDKKYQLEGNAKEIASRYAMECSVNGAKDKSGTNGSHDGVPPINFEMYEKLDSGVRLKKKNRTKEEKEERARRKAERKEKRRLEAEKERFEELNMIKKAKKEEKYIESEKSFTIQTEQEDNEEEITR |
| Length | 293 |
| Position | Head |
| Organism | Strongyloides papillosus (Intestinal threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.030 |
| Instability index | 48.48 |
| Isoelectric point | 5.72 |
| Molecular weight | 33789.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.80| 20| 20| 226| 245| 1
---------------------------------------------------------------------------
226- 245 (32.77/17.09) KNRTKEEK...EERARRKAERKE
246- 268 (27.03/12.95) KRRLEAEKerfEELNMIKKAKKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 163.13| 56| 64| 39| 96| 2
---------------------------------------------------------------------------
39- 96 (87.22/53.85) NNV.SKYNESKKI.....ELAKKLREENKKvGDKfPGFYGVMKKPPNTQK.LLG.SDDILSIYNLR
100- 163 (75.91/39.52) NKVcGKVNEGDSIysildEVIGPLENETYK.SDS.SSLRKLIERPPIVDKeIINfTDQMLKFYDLQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DKFPGFYGV 2) NFEMYEKL | 65 210 | 73 217 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab