<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05266
| Description |
Uncharacterized protein |
| Sequence | MPSISEKDILDIKRRLQQMIDGQKEFVDAPELIAALEGMDITIDILKRTFIGITVNELRKKSGNEALNKRIKSLVKKWKSQMDTNVSKKPSNTPPPPQQDTPASKKPTNNIVRPQPTPSTFTANVKIHKDEYRNKVIGMFISAFNIAELPEGTLDPEDLAVRIEEEHYKSNGGTNDKYKAAIRSKIFNLRDKKNPDLRANVLTGVITPERFATMTSEDMASDAMKKQREKYTQEAIREHQMSVAEGTPTDMFKCGKCRKYNCTYTQVQTRSADEPMTTFVFCRECGNRWKFC |
| Length | 292 |
| Position | Unknown |
| Organism | Strongyloides papillosus (Intestinal threadworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.757 |
| Instability index | 48.58 |
| Isoelectric point | 9.22 |
| Molecular weight | 33287.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.29| 12| 14| 81| 92| 1
---------------------------------------------------------------------------
81- 92 (23.48/15.53) QMDTNVSKKPSN
98- 109 (23.81/15.85) QQDTPASKKPTN
---------------------------------------------------------------------------
|