<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05256
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MGGQNIAGTGTQAVPLLHQSYKNPNFAGNLLNSDNILDYFCDPANIFYDQSSCNQQVKMQNLNRPLNECLQSMNGIQYTLVGANPPLFVIMKQRRNSPTNVTPLCYYYIVNGTVYQCPDLYTFIQSKLIGVVHPLRQALETARQFKEEEESPSSARSTFYQRTRTAFIIQDLFKKFPLPEDVVSCCHFWSYLKCLNVSFLPHFFLLNYLLKLNLVCLAHLYNFYVTL |
| Length | 227 |
| Position | Head |
| Organism | Syphacia muris |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Syphacia.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.100 |
| Instability index | 59.42 |
| Isoelectric point | 8.33 |
| Molecular weight | 26096.75 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05256
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.44| 14| 19| 191| 204| 1
---------------------------------------------------------------------------
191- 204 (27.94/17.31) YLKCLNVSFLPHFF
208- 221 (25.50/15.24) YLLKLNLVCLAHLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.03| 31| 51| 69| 119| 2
---------------------------------------------------------------------------
76- 106 (57.06/58.87) IQYTLVGANPPLFVIM......KQRRNSPTNVTPLCY
124- 160 (45.97/13.57) IQSKLIGVVHPLRQALetarqfKEEEESPSSARSTFY
---------------------------------------------------------------------------
|